PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65060.1
Common NameAGL70, FCL3, MAF3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 196aa    MW: 22129.5 Da    PI: 8.4455
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.5e-20956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krienks rqvtfskRr+g++ KA  LS+LC+  +av+ +s +gkly+
  AT5G65060.1  9 KRIENKSSRQVTFSKRRKGLIEKARQLSILCESSIAVVAVSGSGKLYD 56
                 79********************************************96 PP

2K-box40.11.5e-14951642998
        K-box  29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  e L+  q +l   ++++ s+  L ++e+qLe++l+ iR+kK+el++e ++ lq++ek l een+ L +++
  AT5G65060.1  95 ELLEIVQSKLEESNVDNVSVDSLISMEEQLETALSVIRAKKTELMMEDMKSLQEREKLLIEENQILASQV 164
                  66777777888888999*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.067161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-25174IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-22323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-201055IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.73280170IPR002487Transcription factor, K-box
PfamPF014865.6E-1195164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRRKVEIKR IENKSSRQVT FSKRRKGLIE KARQLSILCE SSIAVVAVSG SGKLYDSASG  60
DNMSKIIDRY EIHHADELKA LDLAEKIRNY LPHKELLEIV QSKLEESNVD NVSVDSLISM  120
EEQLETALSV IRAKKTELMM EDMKSLQERE KLLIEENQIL ASQVGKKTFL VIEGDRGMSR  180
ENGSGNKVPE TLSLLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_A1e-15273171Myocyte-specific enhancer factor 2A
3mu6_B1e-15273171Myocyte-specific enhancer factor 2A
3mu6_C1e-15273171Myocyte-specific enhancer factor 2A
3mu6_D1e-15273171Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.492250.0bud| flower| inflorescence| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247217_s_at1e-118
Expression AtlasAT5G65060-
AtGenExpressAT5G65060-
Functional Description ? help Back to Top
Source Description
TAIRMADS domain protein - flowering regulator that is closely related to FLC
Function -- GeneRIF ? help Back to Top
  1. Association studies support a correlation between the described MAF2-MAF3 gene rearrangements and flowering time variation in the species
    [PMID: 19139056]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2314450.0AY231445.1 Arabidopsis thaliana MADS affecting flowering 3 variant I (MAF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201311.11e-138protein MADS AFFECTING FLOWERING 3
SwissprotQ9FPN71e-120AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBLQ9LSR71e-138Q9LSR7_ARATH; K-box region and MADS-box transcription factor family protein
STRINGAT5G65060.11e-137(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes.
    Plant J., 2000. 24(4): p. 457-66
    [PMID:11115127]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL
    Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold.
    Plant Cell, 2003. 15(5): p. 1159-69
    [PMID:12724541]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  6. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  7. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  8. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  9. Wang J,Tian L,Lee HS,Chen ZJ
    Nonadditive regulation of FRI and FLC loci mediates flowering-time variation in Arabidopsis allopolyploids.
    Genetics, 2006. 173(2): p. 965-74
    [PMID:16547097]
  10. Timms L, et al.
    Analyses of synteny between Arabidopsis thaliana and species in the Asteraceae reveal a complex network of small syntenic segments and major chromosomal rearrangements.
    Genetics, 2006. 173(4): p. 2227-35
    [PMID:16783026]
  11. Cao Y,Dai Y,Cui S,Ma L
    Histone H2B monoubiquitination in the chromatin of FLOWERING LOCUS C regulates flowering time in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2586-602
    [PMID:18849490]
  12. Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD
    Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster.
    Mol. Biol. Evol., 2009. 26(3): p. 699-711
    [PMID:19139056]
  13. Severing EI, et al.
    Predicting the impact of alternative splicing on plant MADS domain protein function.
    PLoS ONE, 2012. 7(1): p. e30524
    [PMID:22295091]
  14. Rosloski SM, et al.
    Functional analysis of splice variant expression of MADS AFFECTING FLOWERING 2 of Arabidopsis thaliana.
    Plant Mol. Biol., 2013. 81(1-2): p. 57-69
    [PMID:23111501]
  15. Xiao J, et al.
    Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis.
    J. Plant Physiol., 2013. 170(4): p. 444-51
    [PMID:23273925]